PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 889aa    MW: 99615.5 Da    PI: 8.8855
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054680.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.84.6e-191842641699
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     l+lp +f++e+g+++++  ++ l  ++g +W  +l  ++++gr++l++GWk+FvkangLk+g++v+++l + +++ +v++++++
  Csa07g054680.1 184 LRLPMQFTRENGINTPG--KIYLLGKDGSKWLANLLLENTRGRMTLGDGWKSFVKANGLKTGESVTLRLCW-EDTIPVLSLCSE 264
                     79**********99766..8*************************************************99.777789888875 PP

2B368.21.2e-21322412498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++++d+lk+grl+lp +f++e++++k++  ++tl  ++g +W v l    k+gr+ l+kGWk+F+kangL++ D+++++l++ +++++ ++++r
  Csa07g054680.1 322 LTITPDSLKHGRLRLPLQFMAENNMDKPG--EITLLGKDGAKWLVSLL-LEKRGRMSLGKGWKDFAKANGLRTDDSITLELIW-ENATPILHLLR 412
                     6789*******************999766..8***************5.66667889**************************.77778887765 PP

3B367.12.6e-21652734186
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     f++ ++++d+l++grl+lp +f++e++++k++  ++tl  ++g +W v l    ++gr+ l+kGWk+F+k+ngLk+gD+++F+ +g
  Csa07g054680.1 652 FLTLTITPDSLRHGRLRLPLDFMTENNMNKPG--EITLLGKNGAKWLVSLL-LERRGRMSLGKGWKNFAKENGLKTGDSITFESIG 734
                     778899********************999766..8***************5.55556789**********************9554 PP

4B349.86.3e-16797882493
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      ++++   + g l lp kf++ +g++k++  ++tl  + g +W  +l    ++g++vl++GWk+F++ang+  gD+++++++ +++++ v
  Csa07g054680.1 797 LTLTPEDVRDGTLHLPSKFMRINGINKPG--QITLLGRGGMKWFAYL--LPRDGTVVLGNGWKGFCEANGVMLGDSFILEFIPKEDTNHV 882
                     455566666778********999999877..6***************..*******************************9966666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010191.3E-24177265IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.2E-17183264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-18183263IPR015300DNA-binding pseudobarrel domain
PfamPF023624.1E-18184264IPR003340B3 DNA binding domain
PROSITE profilePS5086313.126184265IPR003340B3 DNA binding domain
CDDcd100172.45E-16184263No hitNo description
Gene3DG3DSA:2.40.330.107.0E-21311408IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-22315410IPR015300DNA-binding pseudobarrel domain
CDDcd100175.08E-20318412No hitNo description
PROSITE profilePS5086315.312319414IPR003340B3 DNA binding domain
SMARTSM010193.8E-30319414IPR003340B3 DNA binding domain
PfamPF023629.2E-21321412IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-21647742IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-23648743IPR015300DNA-binding pseudobarrel domain
CDDcd100177.51E-19652744No hitNo description
SMARTSM010191.5E-27652747IPR003340B3 DNA binding domain
PROSITE profilePS5086316.525652749IPR003340B3 DNA binding domain
PfamPF023625.0E-20652734IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-19786883IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-22788884IPR015300DNA-binding pseudobarrel domain
CDDcd100171.18E-15793887No hitNo description
SMARTSM010191.4E-19794887IPR003340B3 DNA binding domain
PROSITE profilePS5086314.085794888IPR003340B3 DNA binding domain
PfamPF023625.4E-15794884IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MANSLILGSP INPEKDMMIQ VSDHQNNNIE FQRKKKVKQN NTETEADCSY FNAHVTASSQ  60
QSGRLMANSL ILGSPINPEK DMMIQVSDHQ NNNIEFQRKK KVKQNNTETE ADCSYFNAHV  120
TASSQQSGRL YLPQDFTSSS GLIRKCSKSP PQIISSSDKN FIKFRLAPVD GRHCRLASKI  180
ITALRLPMQF TRENGINTPG KIYLLGKDGS KWLANLLLEN TRGRMTLGDG WKSFVKANGL  240
KTGESVTLRL CWEDTIPVLS LCSEEYITDT RVGKKCSEAS EKEPLPTVPE TKKDESSSWK  300
RENNHMRCID STSPSQNHIL TLTITPDSLK HGRLRLPLQF MAENNMDKPG EITLLGKDGA  360
KWLVSLLLEK RGRMSLGKGW KDFAKANGLR TDDSITLELI WENATPILHL LRIESSSGRG  420
ECDFSKESLP IEPNSGNKAR NSDNNREESK KYPPGSRESS SAIQNQFMAL TRPSGIISQG  480
ALHLQTNEVF IYRNEGGNML QISDLGPYFF GIRDVPAPSS NNDHDRIGNI SMKMHPHLRK  540
EAGFSSYDGD DHDNFERQSK KRVRKNDPET EENCSSDHTR FGAHVTTTSN LHTNELRLAA  600
KESLPIGPSV EKKISEGENS KDKNNMVESS SCGREENHLR CIASISPSQN RFLTLTITPD  660
SLRHGRLRLP LDFMTENNMN KPGEITLLGK NGAKWLVSLL LERRGRMSLG KGWKNFAKEN  720
GLKTGDSITF ESIGLNASHV LSLLYIESSS VRGQSEFPKE SHLTNREERN SRELEKRTYC  780
PSIQNSSSDI QNRFLTLTLT PEDVRDGTLH LPSKFMRING INKPGQITLL GRGGMKWFAY  840
LLPRDGTVVL GNGWKGFCEA NGVMLGDSFI LEFIPKEDTN HVFNFYSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417226.10.0PREDICTED: B3 domain-containing protein REM-like 1 isoform X2
RefseqXP_010417225.10.0PREDICTED: B3 domain-containing protein REM-like 1 isoform X1
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLR0FUN00.0R0FUN0_9BRAS; Uncharacterized protein (Fragment)
STRINGAT2G24690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150791619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24690.10.0B3 family protein